PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG033305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 186aa    MW: 21470.9 Da    PI: 8.85
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG033305.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-3399157159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk+s+fprsYYrCt +gC+vkk+v+r+++d+++v++tYeg H+h+
  CCG033305.1  99 LDDGYRWRKYGQKTVKNSKFPRSYYRCTNNGCNVKKQVQRNSKDEEIVVTTYEGMHTHP 157
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-3484157IPR003657WRKY domain
SuperFamilySSF1182901.57E-2991158IPR003657WRKY domain
PROSITE profilePS5081130.74594159IPR003657WRKY domain
SMARTSM007741.7E-3899158IPR003657WRKY domain
PfamPF031061.2E-27100157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MQMEKYQICL PVSDPSSPSG SPSSLNMANP SIYFHGDNEN GVRPESRTQH SDAKHSDPQT  60
SRVSSNSEIR VKPGMRGGDN NEFRKHKYAF QTRSQVDILD DGYRWRKYGQ KTVKNSKFPR  120
SYYRCTNNGC NVKKQVQRNS KDEEIVVTTY EGMHTHPIEK CTDNIEDILR QMQTYTPFEI  180
MPGHFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2789158776Probable WRKY transcription factor 4
2lex_A3e-2789158776Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089430.0AC208943.1 Populus trichocarpa clone JGIACSB1089-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044111.11e-140PREDICTED: probable WRKY transcription factor 75
TrEMBLB9I3U61e-124B9I3U6_POPTR; Uncharacterized protein
STRINGPOPTR_0012s10290.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-51WRKY DNA-binding protein 75